General Information

  • ID:  hor002033
  • Uniprot ID:  Q95335
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  GNRH1
  • Organism:  Tupaia belangeri (Common tree shrew) (Tupaia glis belangeri)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Tupaia (genus), Tupaiidae (family), Scandentia (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
  • Length:  56
  • Propeptide:  MELVPKFLAGLILLTLCVGGCYAQHWSYGLRPGGKRNAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
  • Signal peptide:  MELVPKFLAGLILLTLCVGGCYA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95335-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002033_AF2.pdbhor002033_ESM.pdb

Physical Information

Mass: 724723 Formula: C272H441N75O92S
Absent amino acids: MVWY Common amino acids: E
pI: 4.33 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 19
Hydrophobicity: -65.71 Boman Index: -12105
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 87.32
Instability Index: 7733.04 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA